Get Tech Support Now - (818) 584-6021 - C2 Technology Partners, Inc.

Get Tech Support Now - (818) 584-6021 - C2 Technology Partners, Inc.

C2 provides technology services and consultation to businesses and individuals.

T (818) 584 6021
Email: [email protected]

C2 Technology Partners, Inc.
26500 Agoura Rd, Ste 102-576, Calabasas, CA 91302

Open in Google Maps
QUESTIONS? CALL: 818-584-6021
  • HOME
  • BLOG
  • SERVICES
    • Encryption
    • Backups
  • ABOUT
    • SMS Opt-In Form
    • Terms and Conditions
    • Privacy Policy
FREECONSULT

Apple joins the ranks of hacked companies

  • 0
admin
Thursday, 21 February 2013 / Published in Woo on Tech
Apple Logo

In a rare public admission, Apple has indicated that some of its own internal Macintoshes have been compromised in a cyberattack that security researchers believe similar to the one that breached Facebook last week. Announcements from Apple of this type are very rare, as Apple has long touted one of the strengths of its platform was how “unhackable” it was compared to Windows. In this particular case, Apple has little to lose, as it’s pointing the finger of blame for the hack at Java and a vulnerability that was taken advantage of to gain access to Apple employee computers.

What this means for you:

Apple’s recent breach is just one more notch in cybercrime’s belt that includes a long list of illustrious companies like the Wall Street Journal, Twitter, Facebook, Jeep, and Burger King, not to mention the numerous intrusions of government agencies and countless hacks of businesses that go unnoticed and un-reported. In the case of the Apple and Facebook breaches, the source has been tied to a  mobile development website that both company’s employees accessed, and according to both companies, there appeared to be no evidence that customer data was compromised in the attacks. As I’ve maintained all along, the business world is now entering a new age of security unknowns as serious criminals continue to exploit technology to serve their needs, and are able to outspend and outgun the average small and medium size business. Before the age of computers and the internet, your odds of being targeted by a criminal organization were minute compared to today, where organized crime can now “crowd-source” affiliate-based networks that pay anonymous hackers in any number of a dozen untraceable ways to rent out zombified computers and webservers by the hour for a handful of dollars, and use pre-scripted attacks to launch massive, shot-gun targeted campaigns that only need to snag a small percentage of victims in order to be profitable. This is not some imaginative, cyberpunk movie plot – it’s happening right now, as you read this article. Moving forward, the only way to combat this growing threat will be a combination of vigilance and smart investments in security technology, policy and training. 

Appleburger kingcybercrimefacebookHackingjava exploitjeepsecurityTwitterwall street journalzero day

Wishing doesn’t make Blackberry Z10 launch successful

  • 0
admin
Thursday, 21 February 2013 / Published in Woo on Tech
BlackBerry Logo

Industry analysts are taking off their rose-colored glasses after examining the results of BlackBerry’s largely lackluster launch of their OS 10 platform. Original estimates had the newly renamed company (formerly Research In Motion) selling as many as  1.75 million new phones following the Jan 30 debut. Using words like “soft launch” and “modest demand”, analysts are now revising their estimates down by as much as 83%, putting BlackBerry’s comeback into serious doubt.

What this means for you:

It’s probably too early to call it, but BlackBerry really needed a big splash with the 10 launch and to keep surging forward with momentum to stay on par with upcoming anticipated Samsung and Apple launches on tap for Summer. Early reviews indicate that version 10 phones have caught up with the competition, but the technology hasn’t leapfrogged the competition, something BlackBerry really needs to do to gain any footing in this market, as they can’t outspend Google, Apple or even Samsung. If your company is heavily invested in BlackBerry and still supports it for corporate communications, you can’t go wrong with a Z10 or Q10, as long as your IT department has committed to keeping their BB infrastructure current. If they seem even the littlest bit wishy-washy on that subject, or they already support Android and iOS devices, you’ll make a safer investment in another platform.

AndroidAppleBlackBerryGoogleiosiPhonelaunchq10RIMsmartphonez10

Jailbreaking iPhones Becoming More Popular

  • 0
admin
Tuesday, 12 February 2013 / Published in Woo on Tech
iOS 6 Jailbroken

If Forbes is writing about it, then it must be entering the mainstream, right? According to their calculations, the latest jailbreak for the iPhone’s iOS 6 has been installed over 7 million times since its release last week, which is roughly equivalent to about 2% of the overall iPhone population, and that number is likely to grow over time to 10% according to Jay Freeman, the administrator of the “unofficial” jailbroken iPhone app store, Cydia.

“Jailbreaking” (similar to “rooting” in the Android world) is basically a process that removes the restriction of installing apps from a third-party app store not controlled by Apple. Apps found at Cydia commonly enable iPhones to do things that normally wouldn’t be possible under Apple’s strict programming and content guidelines, such as (before iOS 6) multitasking or something as simple as setting Google’s Map app as the default mapping application when you click on addresses on your iPhone.

What this means for you:

The explosion in popularity of smartphones and tablets has infused cultures everywhere with elements of hacking and tinkering as people become more comfortable with customizing the phone rather than just using “as directed”, right up to the point where they hit the limitations of the device, and in the case of the iPhone, the (sometimes arbitrary) limits set by Apple. Over the years, jailbreaking, once considered arcane and only for the most foolhardy hacker, has now become something simple enough that you could walk your grandmother through the process.

Let’s be real – jailbreaking your grandmother’s iPad is probably not necessary, but if she could do it, then surely you can do it. And if it means being able to finally get rid of Apple’s miserable Maps application and return to trusty Google Maps once and for all, jailbreaking starts to look a lot more inviting. In the end, jailbreaking is about deciding whether Apple’s vision for how you should use your phone or tablet meets your needs (which it does for the majority of Apple customers) or whether you are really ready to “think different.”

Caveat: Jailbreaking your iPhone or iPad, while legal in the USA, will void your warranty according to Apple.

Appleios 6ipadiPhonejailbreakingrootingwarranty

BlackBerry Faithful: Your Day is Approaching

  • 0
admin
Wednesday, 16 January 2013 / Published in Woo on Tech

Research In Motion (RIM), makers of the once-dominant BlackBerry platform, has announced the launch date of its BlackBerry 10 phones to be January 30 by all the major US carriers except Sprint, who has promised a BB10 phone later in the year. Many analysts believe that this launch is the last-ditch effort by RIM to regain relevance in an industry dominated by iPhone and Android devices, and just as many have already counted them out.

What this means for you:

If you are one of the dwindling BlackBerry faithful, there is a lot to whet your (by now, monstrous) appetite: the new RIM OS modern look and all new code-base (supposedly no carry-over code from older RIM OS’s) will hopefully update BlackBerry’s staid, corporate image. However, the new BB10 phones have multiple strikes against them:

  • Developers for the “staple” apps (Facebook, Google, Netflix, etc) will undoubtedly develop versions of their omnipresent apps because they can fund the development off the backs of their profitable iOS and Android counterparts, but don’t expect surprise hits from indie developers appearing on BB10 first – there just isn’t a large enough userbase to warrant the investment gamble. RIM has sponsored some recent events to kickstart development, but proof will be in whether BB10’s launch will be a repeat of Microsoft’s Windows Phone lackluster debut.
  • BlackBerry’s current infrastructure has some serious redudancy flaws that has led to some titanic outages. Once viewed as the most reliable platform in the early days of smartphones, the series of recent, widespread outages has severely tarnished RIM’s image.
  • RIM has been lapped by Apple and Google, OS-wise, at least 2 to 3 times now. RIM is just launching a competitor to phone OS’s that were developed years ago. Unless this horse can fly, there is no way BB10 is catching iOS6 or Jelly Bean in this race.

I suspect that RIM isn’t quite done – they still have a nice chunk of the market, but they aren’t going to supplant iPhones or Androids anytime soon.

AndroidAppleBB10BlackBerrycarriersGoogleiOS6iPhoneresearch in motionRIMsmartphone

Fake Browser Updates Trick Users

  • 0
admin
Friday, 30 November 2012 / Published in Woo on Tech
ID-10079656.jpg

Hackers are now taking advantage of conscientious users who have been repeatedly warned by folks like myself to keep their software, specifically their browsers, up to date. If a user happens to surf to a website hosting this new style of attack, they will be presented with a realistic-looking warning that asserts their browser is out of date, but if they click the convenient link to update the browser, they instead be infected with a trojan that will forcibly change the browser homepage to a site that will deliver a full payload of malware. If the user is unfortunate enough to have his or her anti-malware software overrun, they will quickly have a severely compromised computer.

What this means for you:

You should only ever download updates for your software from the manufacturer’s website, as it’s extremely unlikely for manufacturers to use third-party hosts for software updates. In the above example, users were directed to download an update from a domain “securebrowserupdate” which is something Microsoft, Google, Mozilla or Apple would never do for their browsers.  If you happen across a pop-up warning that an update is available for your browser, and you aren’t sure it’s legitimate, close it, then check your update status through the browser’s built into the interface, usually under the “Help” menu. Still not sure? Why not call an expert like C2?

Image courtesy of Stuart Miles / FreeDigitalPhotos.net

Applebrowserschromefake updatefirefoxGoogleinternet explorermalwaremicrosoftmozillasafariscamsecurity

Change your router password now

  • 0
admin
Wednesday, 28 November 2012 / Published in Woo on Tech
ID-10071870.jpg

Security researcher Bogdan Calin has reportedly devised a new cyberattack method that can compromise certain types of routers merely by a local user opening an email on their iPhone, iPod or Mac. This new vector takes advantage of two common security weaknesses: the default mail client settings on Apple devices that loads remote images automatically, as well as default or weak admin passwords on consumer-grade routers that are often found in residences and small businesses. In a nutshell, the attack works by taking advantage of your router’s ability to be managed via web-browser by opening dozens of hidden pages with login and setting changes, each firing off in turn until one of them affects the change.

All of this happens in the blink of an eye, and because the changes don’t have to be destructive immediately, the user would not know they had just compromised their own network. These settings could include changing your DNS settings to servers that a hacker controls, allowing them to misdirect anyone on that network to sites that can further hijack computers. For example, typing “Google.com” would no longer take you to the actual Google website, but could instead send you to a counterfeit site that, for all intents and purposes, looks very similar to Google’s own site, and from there, could lure unsuspecting users into further compromising decisions.

What this means for you:

As of now, this particular attack only works on specific types of routers, and relies on the fact that many people have never set their router password to something other than the default it shipped with from the factory. Despite Mr. Calin’s warning, Apple is not planning to address the settings exploit, and has instead suggested that users can turn off the automatic loading of remote images in emails (the default setting in Android mail clients) if they wish additional security, but with the downside that all images, legitimate or not, would be prevented from loading. The simplest solution, of course, is to set your router password to something other than the default, and preferably one that is hard to guess or brute-force.

Image courtesy of Victor Habbick / FreeDigitalPhotos.net

ApplecyberattackemailexploitipadiPhoneiPodMacsecurity

Chrome still tops for avoiding phishers

  • 0
admin
Wednesday, 28 November 2012 / Published in Woo on Tech
No Phishing!

A recent study by security firm NSS Labs shows that Google’s Chrome browser still has the best detection rate (94%) for spotting phishing URLs, and on average, new malware sites are reported and blocked by all browsers within 5 hours of discovery, a significant improvement over the 16+ hours that same process would have taken in 2009. Firefox showed the best response time to reporting and blocking new sites at 2.3 hours – more than twice as quick as IE10.

What this means for you:

All of the major browsers have significantly improved their ability to protect users, to the point that there is very little statistical difference in their security capabilities. Many of my clients still ask me if one is better than the other, and the answer is always, “It depends on what you need the browser to do.” I still use Chrome for most of my work, but there are still enough times when I’m working with online apps that only work with Internet Explorer. The most important factor to consider is making sure whatever browser you do use is kept up to date, and that you practice safe and cautious surfing whenever working with unfamiliar websites.

ApplebrowserchromefirefoxGoogleinternet explorermalwaremicrosoftmozillaphishingsafarisecurity

Surface Tablets: the honeymoon is over

  • 0
admin
Tuesday, 20 November 2012 / Published in Woo on Tech
Microsoft's Surface Tablet

If you’ve held off buying a Surface tablet in the hopes that the new device would settle in and get its legs after a less-than-stellar showing at launch, you have probably been disappointed to find that instead of capturing the hearts and minds of the public (or the media), the Surface continues to struggle for identity in the shadow of the iPad and, to a lesser degree, Google’s Nexus tablets. Zach Epstein at BGR.com had one of the more favorable launch reviews of the tablet, and 30 days later, he updates his stance: he’s still thumbs way up on the hardware, but finds that Microsoft’s innovative hardware is limited by Windows RT, the tablet-only version of Windows 8, and its still-thin selection of apps.

What this means for you:

Mobile warriors looking to get work done via tablet alone (that aren’t already doing it via the iPad or Nexus) may still find themselves hamstrung by the limitations of the Windows RT and the lack-luster selection of apps. Even if you spend most of your time in Microsoft Office, performance of Outlook RT is still poor, and if there’s one thing people won’t suffer, its a slow email client.

Look carefully at the applications you need to exist as a tablet-capable version before chucking your laptop for any tablet (not just the Surface), and even if it does exist, make sure it meets your needs before investing. Die-hard tablet enthusiasts will be able to surmount most of the limitations of Windows RT just by virtue of their innate patience and willingness to “hack” around problems, but if you are someone who’s patience is tried even by the ultra-polished iPad, don’t even think about a Surface at least until the Windows 8 Pro versions arrive in early 2013.

AppleappsGoogleipadmicrosoftnexusreviewsurfacetablet

Go to Denmark for the Safest Computing

  • 0
admin
Wednesday, 07 November 2012 / Published in Woo on Tech
Kaspersky Logo

Kaspersky Labs just released their quarterly threat report for Q3 2012, and it’s dry reading for most folks not fascinated by IT security as I am. There are some notable trends that their research has surfaced, and I thought you might find some of these data points interesting:

  1. You are least likely to be infected by a fellow countryman in the nation of Denmark. (The US is in the lower first quartile, in case you were wondering.)
  2. Russia has overtaken the US as having the most websites hosting malware software.
  3. The most commonly found smartphone virus is designed to steal money from you by texting premium-rate numbers without you noticing.
  4. The most common way to get a virus infection is via drive-by infections, ie. visiting a dodgy website and getting infected when your browser loads pages that have embedded viruses.
  5. Of the top 10 most commonly found software vulnerabilities, 2 are found in Oracle software (Java), 5 from Adobe (Flash, Shockwave & Acrobat), 2 from Apple (Quicktime and iTunes), and 1 from Winamp.
  6. Over half of the detected malware infections came from Java vulnerabilities.
  7. For the first time in many years, Microsoft did not make the Top 10 list of vulnerabilities!

What this means for you:

Keep your software up to date. The java vulnerabilities have been patched, but many people ignore (or aren’t even aware) that Java needs to be kept up to date just like any other software installed on their machine. Keep your browser up to date, and if you have the choice, use the latest version of IE, or even better, Google’s Chrome browser. However, nothing will keep you safe if you don’t have proper malware protection installed, updated and ACTIVE. If you use an Android phone, see my previous article on the dangers of side-loading questionable apps. As of the moment, buying smartphone anti-virus software isn’t at the same state of “must-have” as computers, but we may be fast approaching that point. If you are careful about the apps you install on your phone, you don’t need it…yet.

adobeAndroidAppledrive-by infectionflashitunesjavakaspersky labsmalwareoraclequicktimesecurityside loadingvirus

Malware Apps for Android on the Rise

  • 0
admin
Monday, 05 November 2012 / Published in Woo on Tech
Android Logo

According to analyst IDC, Android-based smartphones account for three out of every 4 phones sold worldwide in Q3 2012. As anticipated, this expansion of the market has also prompted a surge in fraudulent apps being developed and installed on phones. Security firm F-Secure  reports a 10X increase in the number of distinct malware apps detected in the marketplace, finding over 50k apps this quarter alone. Most of these apps appear to be making their debut on 3rd party apps stores outside of the US looser security standards allow the malware to slip into the marketplace undetected.

What this means for you:

Earlier this year, Google implemented a security review process on its official “Play” store, reducing the number of fraudulent apps significantly. However, unlike the iPhone ecosystem, which locks users into only getting apps through its tightly controlled and reviewed iTunes appstore, Androids can bypass the Google’s official appstore to “sideload” apps on their smartphones via a single checkbox setting that is available in the operating system. Just because you can do something doesn’t mean you should. With the possible exception of Amazon’s App Store, I would not recommend installing apps from any 3rd party app store. Amazon.com led the way in sideloading by announcing their own appstore in early 2011, primarily as a means to avoid paying distribution fees to Google to service their own Android-based Kindle devices. Given that keeping their user base safe is probably of utmost concern, it’s likely that Amazon will be carefully reviewing apps distributed through their ecosystem.

If you insist on sideloading apps from a 3rd party app store, make sure you know what you are doing, review the apps carefully, and when in doubt, do your research before installing that magical app that will do it all, and is also free. It may not cost you any money up front, but the longterm damage to your security and identity may be a cost you can’t afford.

amazonAndroidAppleappstoreiPhonekindlemalwaremarketshareplay storesecuritysideloading
  • 3
  • 4
  • 5
  • 6

Recent Posts

  • man working on his desk

    Why We Say Please and Thank You to AI

    A client of mine was using a Claude agent to he...
  • man working on open laptop

    Network Monitoring: Why Professional Services Firms Need 24/7 Oversight

    Your network does not take nights off. Neither ...
  • code in a laptop screen

    Software Updates: When to Install, When to Wait, When to Worry

    On July 19, 2024, CrowdStrike pushed a routine ...
  • half open laptop

    Technology Transparency: Why We Don’t Hide Our Markups

    Go look up Microsoft 365 Business Basic on Micr...
  • mid year check-in

    Mid-Year IT Health Check: 10 Things Professional Services Firms Should Review Now

    Most firms set their technology priorities in J...

Archives

  • GET SOCIAL
Get Tech Support Now - (818) 584-6021 - C2 Technology Partners, Inc.

© 2016 All rights reserved.

TOP